PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G39810.1
Common NameAGL98
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 329aa    MW: 37288.6 Da    PI: 5.918
Description AGAMOUS-like 98
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G39810.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.52e-241765250
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 +++++s +++++s+R+++i+ KA+EL++LCd+e++vi+++++g+l++++
  AT5G39810.1 17 SSSSYSLASTSLSNRLETIFRKASELCTLCDIEACVIYYGPDGELKTWP 65
                 799*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.2E-4767IPR002100Transcription factor, MADS-box
PfamPF003193.7E-132564IPR002100Transcription factor, MADS-box
PROSITE profilePS500669.2922668IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-1426100IPR002100Transcription factor, MADS-box
CDDcd002661.17E-163191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAIRSLPSSS GCSNSSSSSS YSLASTSLSN RLETIFRKAS ELCTLCDIEA CVIYYGPDGE  60
LKTWPPEREK VEDIALRYSQ LNEALRRKKS VTLYDFLNKK KNKTNLEKKA KIKDNDLKRL  120
SLEPHVSKVR ERIRFVESQK HKETKPDHQS LASSSLNNQT QSLNPSQFSL FMYNHGDNIL  180
SQIPVSASNF NQDYFSALLE QSELKSQIMK QEVCGYEQNM CMSNNGDATL SQIPLSASNF  240
NQEFSALLQE ESGLMQQELC NYDQNMFMNN NNFQHSFVSN TQDHSAPAVQ ESVNNNYGLM  300
PHVPCGYDQN LFTSDITNNN LLIDNSMFL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184219140.0
Genevisible249419_s_at0.0
Expression AtlasAT5G39810-
AtGenExpressAT5G39810-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G39810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G39810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0168760.0AB016876.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKM21.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198797.10.0protein AGAMOUS-LIKE 98
SwissprotQ9FIX00.0AGL81_ARATH; Agamous-like MADS-box protein AGL81
TrEMBLQ9FIW60.0Q9FIW6_ARATH; Protein agamous-like 98
STRINGAT5G39810.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Representative plantOGRP6766218
Publications ? help Back to Top
  1. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]